Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

1 - I can do better 2 - Jury's out 3 - Pretty darn good 4 - Splendiferous 5 - Awesometastic by 8 people | Log in to rate

Ranked #451 in Local, #45,577 overall

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

Llanfairpwllgwyngyll (long form Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch), also spelt Llanfair Pwllgwyngyll and commonly known as Llanfair PG or Llanfairpwll, is a village and community on the island of Anglesey in Wales, situated on the Menai Strait next to Menai Bridge and across the strait from Bangor. According to the 2001 census, the population of the community is 3,040, 76% of whom speak Welsh fluently; the highest percentage of speakers is in the 10-14 age group, where 97.1% are able to speak Welsh. It is the fifth largest settlement on the island in terms of population.

The long form of the name is the longest officially recognised place name in the United Kingdom and one of the longest in the world, being 58 letters in length (51 letters in the Welsh alphabet, where "ch" and "ll" count as single letters). The name is Welsh for "St Mary's church in the hollow of the white hazel near to the rapid whirlpool and the church of St Tysilio of the red cave".

This village was originally known as Llanfair Pwllgwyngyll (and is sometimes still referred to as Llanfairpwllgwyngyll) and was given its long name in the 19th century in an attempt to develop the village as a commercial and tourist centre (see Significance of the name below). Today the village is still signposted as Llanfairpwllgwyngyll, marked on Ordnance Survey maps as Llanfair Pwllgwyngyll and is known to locals as Llanfairpwll or simply Llanfair.

The name is also seen shortened to Llanfair PG, which is sufficient to distinguish it from the many other Welsh villages with Llanfair in their names. Other variant forms use the full name but with tysilio mutated to dysilio, and/or with a hyphen between drobwll and llan. In Welsh, the initial Ll may be mutated to a single L in some contexts.

Visitors stop at the railway station to be photographed next to the station sign, visit the nearby Visitors' Centre, or have 'passports' stamped at a local shop. Another tourist attraction is the nearby Marquess of Anglesey's Column, which at a height of 27 metres offers views over Anglesey and the Menai Strait. Designed by Thomas Harrison, the monument celebrates the heroism of Henry Paget, 1st Marquess of Anglesey at the Battle of Waterloo.

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch vids 

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch 0 points

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch blogs 

Updated every 30 minutes

Lord Mandelson of ...
I ran out of space for his title, so I thought I'd better make his title an article... (deep breath) Baron Mandelson of Foy in the county of Herefordshire and Hartlepool in the county of Durham, First Secretary of State, Secretary of ...
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch: Film ...
Speaking of female flesh, that's also the main draw of Barbarella. The difference here is that I'm pretty sure it was meant to be a comedy and the over-the-top nature of everything gives Barbarella the kind of wackiness needed to make ...
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
Yes, you should all be aware that the gobbledigook above is not only Welsh (meaning: ?The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave?, of course), but it is also the ...
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
Wales. This Wales-shaped toast on Strange Maps is a reminder of Wales' silly side. As you study the toast, above, note the protrusion in the top left. There, in Anglesey not far from the ferry to Dublin at Holyhead, is part of Wales' ...

Hang on, what about krungthep mahanakorn The great city of angels? 

Ahh. You mean...

Krungthepmahanakornbowornratanakosinmahintar ayudhyaamahadilokpopnoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatit sakattiyavisanukam?

Although some people say the correct spelling is...

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit (163 letters) - It's the hottest city in the world.

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch Photos 

Updated daily

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by kevingessner

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyll... by Rob Gale

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyll... by Rob Gale

Llanfairpwllgwyngyll...

Project 365 #51: 200209 Pronounced "Buuurgeeer Kiiing" by comedy_nose

Project 365 #51: 200...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by espinr

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by espinr

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by espinr

Llanfairpwllgwyngyll...

DSCF7004 by mattbuck4950

DSCF7004

DSCF7003 by mattbuck4950

DSCF7003

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by janetmck

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by janetmck

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch Railway Station by Rainer Ebert

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by Rainer Ebert

Llanfairpwllgwyngyll...

In Tribute by Andrew Stawarz

In Tribute

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch by Neil T

Llanfairpwllgwyngyll...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch news 

Updated every 30 minutes

Longest domain name-world record set by Llanfairpwllgw ...
Thousands of visitors each year visit the small village of llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch made internationally famous through is ...
Country Diary: Ben Fogle
... Welsh village where I had to pronounce the name of the town with the longest name in the UK: Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. ...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch links 

Llanfairpwll - tourist sites, info, accommodation in Llanfair PG in Anglesey, North Wales, Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
Llanfairpwll Home Page. LlanfairPG is a welsh village in the south of Anglesey, North Wales
BBC - h2g2 - Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, Anglesey, Wales
h2g2 is the unconventional guide to life, the universe and everything, a guide that's written by visitors to the website, creating an organic and evolving encyclopedia of life
Llainfair PG, Anglesey, North Wales, UK
Llanfair PG Station - Places of Interest, Tourists Attractions and Activities, Places to see and visit on the Isle of Anglesey, North Wales, UK

Comments 

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

StrangeConversation wrote...

Nice lens. I've lensrolled this with mine on Snowdon.

ReplyPosted June 25, 2009

ashroc wrote...

excellent info! always wondered about what that name meant :)

ReplyPosted May 06, 2009

paperfacets wrote...

Lovely little town. We stopped there on our British Isles tour. No swimming in the cold surf, though.

ReplyPosted February 20, 2009

cleansweeping wrote...

How interesting!!!!

ReplyPosted July 21, 2008

mulberry wrote...

Unbelievable, I would imagine the people there become phenomenal spellers.

ReplyPosted July 08, 2008

 
1 of 2 pages

BYE! 

Hope to see you again soon...

HILLANDGLEN

Hillandglen Recommends...

Create a Lens!